PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA21G00384
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 595aa    MW: 67163.2 Da    PI: 7.0907
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA21G00384genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3727.6e-23127227198
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++ l
  AA21G00384 127 FVKILTASDTSTHGGFSVLRKHATEClpaldmtQ--ATPTQELVAKDLNGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGENGDL 221
                 89****************************9543..445569************************************************..3488889 PP

                 EEEEE- CS
          B3  93 vvkvfr 98 
                 +v+v+r
  AA21G00384 222 RVGVRR 227
                 ***998 PP

2Auxin_resp89.46.5e-30253332183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++t++ F v+Y+Pr   s+F+++++k++ a+k+ + vG Rf+m+fe+e+s+er ++Gt+vg  d+++ +W  SkWrsL+
  AA21G00384 253 ASHAVKTNTLFVVFYKPRI--SQFIISLNKYMVAIKHGFGVGIRFRMRFEGEESPERIFTGTIVGSGDISS-QWVASKWRSLQ 332
                 789***************8..9**********************************************777.*********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.09E-39112256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.5E-38121242IPR015300DNA-binding pseudobarrel domain
CDDcd100174.82E-20126227No hitNo description
PfamPF023625.3E-21127227IPR003340B3 DNA binding domain
PROSITE profilePS5086312.196127229IPR003340B3 DNA binding domain
SMARTSM010195.7E-21127229IPR003340B3 DNA binding domain
PfamPF065071.3E-27253332IPR010525Auxin response factor
PfamPF023095.7E-11425562IPR033389AUX/IAA domain
SuperFamilySSF542771.23E-13471554No hitNo description
PROSITE profilePS5174527.02478570IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MANVDGDFRD SCERSGSYEE QLYRELWKAC AGPLVEVPRS GERVFYFPQG HMEQLVASTN  60
QGVDQEIPVF NLPSKILCRV LSVMLKAEHE TDEVYAQITL RPEEDQNEPT SLDPPIMEPA  120
KQPVDSFVKI LTASDTSTHG GFSVLRKHAT ECLPALDMTQ ATPTQELVAK DLNGYEWRFK  180
HIFRGQPRRH LLTTGWSTFV TSKRLVAGDA FVFLRGENGD LRVGVRRLAR QQSTMPASVI  240
SSQSMHLGVL ATASHAVKTN TLFVVFYKPR ISQFIISLNK YMVAIKHGFG VGIRFRMRFE  300
GEESPERIFT GTIVGSGDIS SQWVASKWRS LQVQWDEPSS VHRPNKVSPW EIEPFVQSTT  360
MSTTLTQSQA KSKRSRPINS SISEITGSPK GSNMFQQSHE SLKQLFQDQT NSTKSIQYSS  420
EQSQKAETPT SSSYRLFGFD LMSNNKPAAP IPPDKQQLIS LDSDISCLNS PKTQKQTRSR  480
TKVQMQGTAV GRAVDLTLLR SYEELINELE KMFEIKGELS RGEKWAVVFT DDEGDMMLLG  540
DDPWNEFCKM VKKLFIYSSE EVKKMKSKTK KCSLLDDEGV IINLESDLDQ RVNEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1711635513355Auxin response factor 1
4ldw_A1e-1711635513355Auxin response factor 1
4ldw_B1e-1711635513355Auxin response factor 1
4ldx_A1e-1711635513355Auxin response factor 1
4ldx_B1e-1711635513355Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006397845.10.0hypothetical protein EUTSA_v10001365mg
SwissprotQ9ZPY60.0ARFK_ARATH; Auxin response factor 11
TrEMBLV4LHN40.0V4LHN4_EUTSA; Auxin response factor
STRINGscaffold_403621.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM74351841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46530.10.0auxin response factor 11